Wpskins.org

Website Overview

Wpskins.org has Google Pagerank of 4 and ranks #144,981 in the World among 30 million domains based on Alexa traffic ranking. For traffic rank, lower is better. The website has potential daily advertising revenue of $82 USD and daily pageviews of 3,497 with network bandwidth consumption of 1,119,096 KB. After evaluation, we found that Wpskins.org has estimated worth of $43,194 USD that has similar value to Defenseindustrydaily.com, Taiwanus.net, Tokyolife.co.jp, Akorda.kz, Youngbuzz.com.

The website is currently hosted at Softcom Technology Consulting with primary IP address of 168.144.159.37 on the server that is located in Toronto, Canada CA on the nameservers: ns2.myhosting.com, ns.myhosting.com, ns1.myhosting.com. You can also review its unique visitors and traffic rank trend in the following section. This report is last updated on April 18, 2013.

Alexa Rank: ranks #144,981 in the World
Estimated Value: $43,194 USD
Daily Earning: $82 USD
Monthly Earning: $2,473 USD
Daily Pageviews: 3,497
Monthly Pageviews: 104,915
Network Bandwidth: 1,119,096 KB per Day
Monthly Bandwidth: 33,572,885 KB
Google Pagerank: Pagerank 4 4/10
Site URL: http://wpskins.org
Domain Keyword: wpskins
Length: 7 characters
Favicon:
Reverse IP: 168.144.159.37
IP Location: Canada CA
IP Conversion: Decimal: 2828050213
Octal: 0250.0220.0237.0045
Binary: 10101000100100001001111100100101
Hexadecimal: A8.90.9F.25
Nameservers: ns2.myhosting.com
ns.myhosting.com
ns1.myhosting.com
Hosting Company: Softcom Technology Consulting

Note: website value, pageviews and bandwidth consumption are estimated values only.

List of suggested search keywords with competition level, cost per click value on the market and monthly global search volume.

Keyword Competition CPC (USD) Search Volume
wrangler 0.60
Medium
$ 1.362,740,000
wrangler 2011 0.69
High
$ 2.5040,500
wrangler bumper 0.95
High
$ 0.9912,100
wr racing 0.05
Low
$ 0.5127,100
wr 100 citizen 0.57
Medium
$ 0.5114,800
wrangler forum 0.14
Low
$ 0.9427,100
wr forum 0.03
Low
$ 0.13165,000
wrangler accessories 1.00
High
$ 1.1227,100
wr grace 0.04
Low
$ 2.4822,200
wrangler 2007 0.62
Medium
$ 1.4540,500
wpw wolf parkinson white 0.05
Low
$ 0.8212,100
wrangler doors 0.94
High
$ 1.3814,800
wr fantasy 0.01
Low
$ 1.1014,800
wral 0.00
Low
$ 0.78673,000
wpw parkinson 0.04
Low
$ 0.5622,200
wrangler 2010 0.70
High
$ 2.1722,200
wrangler duratrac 0.70
High
$ 1.4314,800
wr. grace 0.04
Low
$ 2.4822,200
wrangler 4 door 0.87
High
$ 2.6822,200
wrangler dura trac 0.73
High
$ 1.3712,100
wrangler door 0.87
High
$ 2.3440,500
wrangler engine 0.59
Medium
$ 1.1314,800
wrangler cover 1.00
High
$ 1.4827,100
wradio colombia 0.00
Low
$ 0.2914,800
wral news 0.02
Low
$ 0.5133,100

Domain Name Analysis

The domain name: wpskins.org is gotten from the combination of "wpskins" term and ".org" extension.

Domain name: wpskins.org
Sha1 Hash: c5dd3c83d8ea8af2ec10f91f2ee2ecb9025f4b80
Md5 Hash: e2c0e2cbfa842b03cc75916506a6e7a9
Keyword: wpskins
Letter: there are 7 letters I K N P S S W to form a term: wpskins
Extension: .org
Google Pagerank: Pagerank 4 4/10

Title and Meta Tags

Title and description tag are a great way for webmasters to provide search engines with information about their sites. Here is the analysis result for wpskins.org.

Title: Free WordPress Themes - Adsense Ready Wordpress Themes - wpSkins.org
Length: 68 character(s)

Description: A collection of Free WordPress Themes to preview and download. Currently hosting over 13,000 free wordpress themes to download for your wordpress blog. Search for and rate your favourite themes. Multiple search functions to find your theme quickly.
Length: 248 character(s)

Note: Title tag should contain between 10 and 70 characters (spaces included).
Description tag should contain between 70 to 160 characters (spaces included).

Server Location

Wpskins.org is currently hosted at Softcom Technology Consulting on the primary IP address of 168.144.159.37. This server is located in Toronto, Canada. Its latitude: 43.666698455811 and longitude: -79.416702270508.

Hosting: Softcom Technology Consulting
Organization: Softcom
City: Toronto
Region / State: ON Ontario
Country Name: Canada CA
Country Code: CA
Latitude: 43.666698455811
Longitude: -79.416702270508
Postal Code: m5j2r8
Area Code: n/a
Metro Code: n/a
Time Zone: America/Rainy_River

IP Address Conversion

Wpskins.org has IP address of 168.144.159.37, see the following for conversion results into decimal, hexadecimal, octal and binary.

Decimal: 2828050213
Hexadecimal: A8.90.9F.25
Octal: 0250.0220.0237.0045
Binary: 10101000100100001001111100100101

Nearby IP Domains

List of websites that have nearby IP address to wpskins.org

No Domain Name IP Address Keyword
1 novecento.rs168.144.18.30Novecento
2 pntglobal.com168.144.161.63Pntglobal
3 easygps.com168.144.186.91Easygps
4 harvardpolitics.com168.144.170.62Harvardpolitics
5 crisiswhatcrisis.ca168.144.170.12Crisiswhatcrisis
6 indianclassifieds.com168.144.164.166Indianclassifieds
7 filipinouk.co.uk168.144.170.171Filipinouk
8 boiteachansons.net168.144.196.153Boiteachansons
9 4weddings.gr168.144.159.724weddings
10 promo-code.co.za168.144.170.66Promo-code
11 sesawi.net168.144.159.82Sesawi
12 goodcooking.com168.144.179.139Goodcooking
13 cropzoom.com.ar168.144.171.41Cropzoom
14 chiringadecuba.com168.144.196.139Chiringadecuba
15 classifiedads.org.za168.144.170.66Classifiedads
16 njlawman.com168.144.182.70Njlawman
17 aljomaihauto.com168.144.170.188Aljomaihauto
18 localblue.com.au168.144.170.74Localblue
19 banderasnews.com168.144.182.127Banderasnews
20 seviervillechamber.org168.144.167.195Seviervillechamber
21 bloggink.com168.144.170.126Bloggink
22 bobborst.com168.144.179.120Bobborst
23 desimates.com168.144.170.198Desimates
24 livingwaychristianfriendshipgroup.com168.144.170.174Livingwaychristianfriendshipgroup
25 aqarlink.com168.144.171.125Aqarlink

DNS Records Analysis

We found the following DNS Records about wpskins.org.

Type Target / IP Ttl
A168.144.159.373600
MXmail.wpskins.org3600
NSns2.myhosting.com3600
NSns.myhosting.com3600
NSns1.myhosting.com3600
SOAlinda.elyme.com3600

Note: A = address record, NS = name server record, MX = mail exchange record, SOA = start of [a zone of] authority record.

HTTP Headers Analysis

The header fields sent by the server in response to a HTTP (Hypertext Transfer Protocol) request for wpskins.org.

HTTP/1.1 200 OK
Date: Thu, 23 May 2013 11:07:01 GMT
Server: Apache/2.2.22 (Unix) mod_ssl/2.2.22 OpenSSL/0.9.8e-fips-rhel5 mod_auth_passthrough/2.1 mod_bwlimited/1.4 FrontPage/5.0.2.2635
X-Powered-By: PHP/5.3.10
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Set-Cookie: PHPSESSID=557d9f469cbc1ae361fe8ac9fa6cb3a2; path=/
Connection: close
Content-Type: text/html

Sites Like Wpskins.org

List of website similar to wpskins.org sorted by popularity rank.

Similar Value Websites

List of websites that have similar estimated value to wpskins.org

No Domain Name Worth Keyword
1 defenseindustrydaily.com$ 54,189Defenseindustrydaily
2 taiwanus.net$ 44,188Taiwanus
3 tokyolife.co.jp$ 44,192Tokyolife
4 akorda.kz$ 119,190Akorda
5 youngbuzz.com$ 44,191Youngbuzz
6 turksatkablo.com.tr$ 54,191Turksatkablo
7 niftyfutureking.com$ 32,688Niftyfutureking
8 roastedbeanz.com$ 36,189Roastedbeanz
9 firstcarrental.co.za$ 54,191Firstcarrental
10 gatoconbota.com$ 40,191Gatoconbota
11 hansa-realty.com$ 44,192Hansa-realty
12 sabyemarket.com$ 34,190Sabyemarket
13 type-fu.com$ 44,187Type-fu
14 inhousepharmacy.biz$ 40,191Inhousepharmacy
15 fullpelix.com$ 32,692Fullpelix
16 directorychamp.com$ 34,190Directorychamp
17 pxb.com.cn$ 32,690Pxb
18 teara.govt.nz$ 75,188Teara
19 efw.cn$ 54,188Efw
20 xrumergeek.com$ 40,190Xrumergeek
21 creativedesignmagazine.com$ 40,188Creativedesignmagazine
22 banklife.ru$ 44,191Banklife
23 chinacloud.cn$ 54,191Chinacloud
24 unitec.ac.nz$ 119,189Unitec
25 waat.nl$ 40,193Waat

Compete Statistics

Unique Visitors, Popularity Rank and Visits Trend Graphs for Wpskins.org. These graphs are provided by Compete.

Compete Rank

Wpskins.org popularity rank trend at Compete. For Compete Rank, the lower is the better.

Unique Visitors

Total number of people in United States who visited the website every single month.

Visits Trend

Total number of times that users visited wpskins.org for the last 13 months.

Alexa Statistics For Wpskins.org Review

Use these graphs to review the website Daily Traffic Rank Trend, Daily Reach, Daily Pageviews, Time on Site, Bounce Rate and Search Visits. These stats are provided by Alexa.

Daily Traffic Rank Trend

The daily global traffic ranking trend in the last 6 months. Wpskins.org is currently ranked #144,981 in the World among 30 million domains.

Daily Reach (Percent)

The estimated percentage of global internet users who visited wpskins.org.

Daily Pageviews (Percent)

The estimated percentage of global pageviews trend for the last 6 months.

Daily Pageviews Per User

The average number of unique pageviews per visitor per day trend within 6 months period.

Time on Site (Minutes)

The average time that every visitor spent on wpskins.org for the last 3 months.

Search Visits (Percent)

The percentage of the traffics that came to wpskins.org from the major search engines.

Bounce Rate (Percent)

The percentage of visits that visited only a single pageview and then exit the website.

Quantcast Statistics

This line chart illustrates the total number of visitors (United States Only) who visited wpskins.org for the last 6 months period. This stats is provided by Quantcast.

This graph is showing you the backlinks trend for wpskins.org in the past 12 months. The stats is provided by MAJESTIC SEO.

Last updated 2013/04/18
Back ot Top
Worth Widget
Worth Widget Copy and Paste Code at Your Website.
Useful Tools

Web Stats Comparison Web Stats Comparison
Compare website traffic, popularity ranking, unique visitor and pageviews.
Up to 4 domains.

IP Location Finder IP Location Finder
Find the location of an IP address or website.
View it on Google Map.

Whois Record Lookup Whois Record Lookup
Lookup domain and IP whois records to find who is behind the website.
Owner contact address.

Additional Useful Tools Additional Useful Tools
Website speed test and security check, CSS and markup validation service.
More free tools.